Structure of PDB 5ool Chain o

Receptor sequence
>5oolo (length=91) Species: 9606 (Homo sapiens) [Search protein sequence]
IPGRQWIGKHRRPRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQERG
HAAVRRREAFEAIKAAATSKFPPHRFIADQLDHLNVTKKWS
3D structure
PDB5ool Structures of the human mitochondrial ribosome in native states of assembly.
Chaino
Resolution3.06 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o I12 P13 R15 Q16 W17 I18 G19 K20 H21 R25 F26 S28 R30 N34 R56 R60 G61 H62 A63 A64 R66 R67 F71 I74 K75 A78 K81 R86 H94 K100 I1 P2 R4 Q5 W6 I7 G8 K9 H10 R14 F15 S17 R19 N23 R45 R49 G50 H51 A52 A53 R55 R56 F60 I63 K64 A67 K70 R75 H83 K89
BS02 MG o G14 R15 G3 R4
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ool, PDBe:5ool, PDBj:5ool
PDBsum5ool
PubMed28892042
UniProtQ9BQC6|RT63_HUMAN Large ribosomal subunit protein mL63 (Gene Name=MRPL57)

[Back to BioLiP]