Structure of PDB 5luf Chain o

Receptor sequence

>5lufo (length=379) Species: 9913 (Bos taurus)

MTNIRKSHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLF
LAMHYTSDTTTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLYMHVGR
GLYYGSYTFLETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLL
SAIPYIGTNLVEWIWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFL
HETGSNNPTGISSDVDKIPFHPYYTIKDILGALLLILALMLLVLFAPDLL
GDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILI
LALIPLLHTSKQRSMMFRPLSQCLFWALVADLLTLTWIGGQPVEHPYITI
GQLASVLYFLLILVLMPTAGTIENKLLKW

3D structure

• PDB: 5luf Functional asymmetry and electron flow in the bovine respirasome.
• Chain: o
• Resolution: 9.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	o	Q44 I45 G48 L49 L51 A52 Y55 R80 H83 T126 G130 Y131 P134 H182 F183 P186	Q44 I45 G48 L49 L51 A52 Y55 R80 H83 T126 G130 Y131 P134 H182 F183 P186
BS02	HEM	o	W31 G34 L37 L94 H97 R100 S106 T112 W113 G116 V117 L119 H196 L197 L200 S205 N206	W31 G34 L37 L94 H97 R100 S106 T112 W113 G116 V117 L119 H196 L197 L200 S205 N206

Gene Ontology

Molecular Function

• GO:0008121 ubiquinol-cytochrome-c reductase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0048039 ubiquinone binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0022904 respiratory electron transport chain
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0016020 membrane
• GO:0031966 mitochondrial membrane
• GO:0045275 respiratory chain complex III

External links

• PDB: RCSB:5luf, PDBe:5luf, PDBj:5luf
• PDBsum: 5luf
• PubMed: 27830641
• UniProt: P00157|CYB_BOVIN Cytochrome b (Gene Name=MT-CYB)