Structure of PDB 5li0 Chain o

Receptor sequence
>5li0o (length=88) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
AISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHH
SRRGLLKMVGRRRHLLNYLRSKDIQRYRELIKSLGIRR
3D structure
PDB5li0 Structure of the 70S ribosome from human pathogen Staphylococcus aureus.
Chaino
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o A2 Q5 N9 H18 D21 T22 G23 S24 H42 H46 K47 K48 D49 H51 R54 M59 R62 H65 Y69 K73 A1 Q4 N8 H17 D20 T21 G22 S23 H41 H45 K46 K47 D48 H50 R53 M58 R61 H64 Y68 K72
BS02 rna o N40 R44 R63 R64 R89 N39 R43 R62 R63 R88
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5li0, PDBe:5li0, PDBj:5li0
PDBsum5li0
PubMed27906650
UniProtQ2G2Q1|RS15_STAA8 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]