Structure of PDB 5imq Chain o

Receptor sequence
>5imqo (length=110) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKV
LESAAANAVNNHDMLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRT
SHITVILGEK
3D structure
PDB5imq Structure of the GTP Form of Elongation Factor 4 (EF4) Bound to the Ribosome
Chaino
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o K4 I6 R11 S13 R15 K16 R18 K41 R42 A56 N57 N60 N61 Y75 D77 E78 L82 K83 R84 P87 R88 A89 R90 G91 R92 A93 D94 I96 K97 R99 H102 K4 I6 R11 S13 R15 K16 R18 K41 R42 A56 N57 N60 N61 Y75 D77 E78 L82 K83 R84 P87 R88 A89 R90 G91 R92 A93 D94 I96 K97 R99 H102
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5imq, PDBe:5imq, PDBj:5imq
PDBsum5imq
PubMed27137929
UniProtQ5SHP3|RL22_THET8 Large ribosomal subunit protein uL22 (Gene Name=rplV)

[Back to BioLiP]