Structure of PDB 5gak Chain o

Receptor sequence
>5gako (length=52) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
IIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRPKKK
LK
3D structure
PDB5gak Structure of the hypusinylated eukaryotic translation factor eIF-5A bound to the ribosome.
Chaino
Resolution3.88 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o R97 Y100 R102 P104 R106 R111 K112 R113 K114 R122 K124 K125 R21 Y24 R26 P28 R30 R35 K36 R37 K38 R46 K48 K49
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0031386 protein tag activity
GO:0031625 ubiquitin protein ligase binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000055 ribosomal large subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0016567 protein ubiquitination
GO:0019941 modification-dependent protein catabolic process
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gak, PDBe:5gak, PDBj:5gak
PDBsum5gak
PubMed26715760
UniProtP0CH08|RL40A_YEAST Ubiquitin-ribosomal protein eL40A fusion protein (Gene Name=RPL40A)

[Back to BioLiP]