Structure of PDB 3j7y Chain o

Receptor sequence

>3j7yo (length=94) Species: 9606 (Homo sapiens) [Search protein sequence]

RGRIPGRQWIGKHRRPRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQ
ERGHAAVRRREAFEAIKAAATSKFPPHRFIADQLDHLNVTKKWS

3D structure

PDB

3j7y Structure of the large ribosomal subunit from human mitochondria.

Chain

Resolution

3.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	o	R9 R11 I12 P13 G14 R15 Q16 W17 I18 G19 K20 H21 R22 R23 R25 F26 S28 R30 A31 N34 R38 R56 R60 G61 H62 A63 R66 R67 F71 I74 K75 A78 K81 R86 H94 K100	R1 R3 I4 P5 G6 R7 Q8 W9 I10 G11 K12 H13 R14 R15 R17 F18 S20 R22 A23 N26 R30 R48 R52 G53 H54 A55 R58 R59 F63 I66 K67 A70 K73 R78 H86 K92

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005761	mitochondrial ribosome
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:3j7y, PDBe:3j7y, PDBj:3j7y
PDBsum	3j7y
PubMed	25278503
UniProt	Q9BQC6\|RT63_HUMAN Large ribosomal subunit protein mL63 (Gene Name=MRPL57)