Structure of PDB 8ip9 Chain na

Receptor sequence

>8ip9na (length=125) Species: 4565 (Triticum aestivum) [Search protein sequence]

VFGVAHIFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML
ASQDVATRCKELGITALHIKLRATGGNKTKTPGPGAQSALRALARSGMKI
GRIEDVTPVPTDSTRRKGGRRGRRL

3D structure

PDB

8ip9 Boric acid intercepts 80S ribosome migration from AUG-stop by stabilizing eRF1.

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	na	H32 F34 N38 D39 F41 H43 S48 G49 R50 E51 T52 R55 T57 G59 D65 R66 V135 P136 T137 D138 T140 R141 R142 K143 G144 G145 R146 R147 R149 R150 L151	H6 F8 N12 D13 F15 H17 S22 G23 R24 E25 T26 R29 T31 G33 D39 R40 V109 P110 T111 D112 T114 R115 R116 K117 G118 G119 R120 R121 R123 R124 L125

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links