Structure of PDB 4u4u Chain n8

Receptor sequence

>4u4un8 (length=148) Species: 559292 (Saccharomyces cerevisiae S288C)

PSRFTKTRKHRGHVSAGKGRIGKHRKHPGGRGMAGGQHHHRINMDKYHPG
YFGKVGMRYFHKQQAHFWKPVLNLDKLWTLIPEDKRDQYLKSASKETAPV
IDTLAAGYGKILGKGRIPNVPVIVKARFVSKLAEEKIRAAGGVVELIA

3D structure

• PDB: 4u4u ?
• Chain: n8
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	n8	P2 S3 R4 F5 K7 T8 R9 K10 H11 R12 G13 H14 V15 S16 A17 G18 K19 G20 R21 I22 G23 H25 R26 K27 H28 P29 G30 G31 R32 G33 M34 A35 G36 Q38 H40 H41 R42 I43 N44 K47 Y52 F53 G54 K55 V56 G57 M58 R59 Y60 F61 H62 K63 Q64 H67 N74 K111 L113 G114 K115 R117 S131 K132 L133	P1 S2 R3 F4 K6 T7 R8 K9 H10 R11 G12 H13 V14 S15 A16 G17 K18 G19 R20 I21 G22 H24 R25 K26 H27 P28 G29 G30 R31 G32 M33 A34 G35 Q37 H39 H40 R41 I42 N43 K46 Y51 F52 G53 K54 V55 G56 M57 R58 Y59 F60 H61 K62 Q63 H66 N73 K110 L112 G113 K114 R116 S130 K131 L132
BS02	OHX	n8	G23 K24	G22 K23

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4u4u, PDBe:4u4u, PDBj:4u4u
• PDBsum: 4u4u
• PubMed: 25209664
• UniProt: P02406|RL28_YEAST Large ribosomal subunit protein uL15 (Gene Name=RPL28)