Structure of PDB 4u53 Chain n7

Receptor sequence
>4u53n7 (length=135) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
AKFLKAGKVAVVVRGRYAGKKVVIVKPHDEGSKSHPFGHALVAGIERYPL
KVTKKHGAKKVAKRTKIKPFIKVVNYNHLLPTRYTLDVEAFKSVVSTETF
EQPSQREEAKKVVKKAFEERHQAGKNQWFFSKLRF
3D structure
PDB4u53 ?
Chainn7
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna n7 R15 G16 R17 F38 R48 K52 T54 K55 K56 K61 K64 K67 K69 K73 N76 H79 K111 K112 K115 K133 R135 F136 R14 G15 R16 F37 R47 K51 T53 K54 K55 K60 K63 K66 K68 K72 N75 H78 K110 K111 K114 K132 R134 F135
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4u53, PDBe:4u53, PDBj:4u53
PDBsum4u53
PubMed25209664
UniProtP0C2H6|RL27A_YEAST Large ribosomal subunit protein eL27A (Gene Name=RPL27A)

[Back to BioLiP]