Structure of PDB 4u56 Chain n5

Receptor sequence

>4u56n5 (length=120) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

ALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRLDSYKVIEQPITSETA
MKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTKKA
YVRLTADYDALDIANRIGYI

3D structure

PDB

4u56 ?

Chain

Resolution

3.45 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	n5	L24 T31 F32 R33 L34 T37 L40 R42 A43 K45 Y46 S69 T71 K75 N91 K92 Y93 N111 T112 L113 V114 K120 Y123 R125	L2 T9 F10 R11 L12 T15 L18 R20 A21 K23 Y24 S47 T49 K53 N69 K70 Y71 N89 T90 L91 V92 K98 Y101 R103
BS02	rna	n5	P35 L38 R42 S48 K49 H53 Y54 N55 R56 K61 K89 Y93 Q94	P13 L16 R20 S26 K27 H31 Y32 N33 R34 K39 K67 Y71 Q72

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0030687	preribosome, large subunit precursor
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4u56, PDBe:4u56, PDBj:4u56
PDBsum	4u56
PubMed	25209664
UniProt	P04456\|RL25_YEAST Large ribosomal subunit protein uL23 (Gene Name=RPL25)