Structure of PDB 4u4q Chain n4

Receptor sequence
>4u4qn4 (length=135) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIA
WTVLFRKHHKKGITEEVAKKRSRKTVKAQRPITGASLDLIKERRSLKPEV
RKANREEKLKANKEKKKAEKAARKAEKAKSAGTQS
3D structure
PDB4u4q ?
Chainn4
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna n4 N112 K113 K120 R123 N112 K113 K120 R123
BS02 rna n4 G16 R17 G18 S34 K35 S38 Q42 K44 R48 I49 A50 W51 R56 K61 G16 R17 G18 S34 K35 S38 Q42 K44 R48 I49 A50 W51 R56 K61
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006413 translational initiation
GO:0006414 translational elongation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4u4q, PDBe:4u4q, PDBj:4u4q
PDBsum4u4q
PubMed25209664
UniProtP04449|RL24A_YEAST Large ribosomal subunit protein eL24A (Gene Name=RPL24A)

[Back to BioLiP]