Structure of PDB 4u4n Chain n3

Receptor sequence

>4u4nn3 (length=136) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

SGNGAQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPA
ASLGDMVMATVKKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGV
IANPKGEMKGSAITGPVGKECADLWPRVASNSGVVV

3D structure

PDB

4u4n ?

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	n3	R32 P67	R31 P66
BS02	rna	n3	G8 K10 F11 R12 S14 G16 P18 A21 Y35 I37 K40 S44 R45 L46 N47 R48 L49 M59 T61 K63 K71 V73 K83 R88 F92 N98	G7 K9 F10 R11 S13 G15 P17 A20 Y34 I36 K39 S43 R44 L45 N46 R47 L48 M58 T60 K62 K70 V72 K82 R87 F91 N97
BS03	OHX	n3	D27 T115	D26 T114
BS04	OHX	n3	S133 G134	S132 G133

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0070180	large ribosomal subunit rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4u4n, PDBe:4u4n, PDBj:4u4n
PDBsum	4u4n
PubMed	25209664
UniProt	P0CX41\|RL23A_YEAST Large ribosomal subunit protein uL14A (Gene Name=RPL23A)