Structure of PDB 4u4n Chain n2

Receptor sequence
>4u4nn2 (length=98) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
IAKTFTVDVSSPTENGVFDPASYAKYLIDHIKVEGAVGNLGNAVTVTEDG
TVVTVVSTAKFSGKYLKYLTKKYLKKNQLRDWIRFVSTKTNEYRLAFY
3D structure
PDB4u4n ?
Chainn2
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna n2 K13 K42 V43 E44 S72 K74 Y75 K77 Y78 K81 K82 K85 K86 R90 R94 V96 S97 T100 N101 Y103 R104 K3 K32 V33 E34 S62 K64 Y65 K67 Y68 K71 K72 K75 K76 R80 R84 V86 S87 T90 N91 Y93 R94
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4u4n, PDBe:4u4n, PDBj:4u4n
PDBsum4u4n
PubMed25209664
UniProtP05749|RL22A_YEAST Large ribosomal subunit protein eL22A (Gene Name=RPL22A)

[Back to BioLiP]