Structure of PDB 7r81 Chain n1

Receptor sequence
>7r81n1 (length=50) Species: 5141 (Neurospora crassa) [Search protein sequence]
PSHKTFRVKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGL
3D structure
PDB7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide
Chainn1
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna n1 P2 S3 H4 K5 F7 K10 L13 I35 Y37 R41 R42 H43 W44 R45 T47 R48 L49 P1 S2 H3 K4 F6 K9 L12 I34 Y36 R40 R41 H42 W43 R44 T46 R47 L48
BS02 rna n1 T6 F7 K15 K18 Q19 R21 I23 P24 W26 I27 L29 R30 T31 K40 T5 F6 K14 K17 Q18 R20 I22 P23 W25 I26 L28 R29 T30 K39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r81, PDBe:7r81, PDBj:7r81
PDBsum7r81
PubMed34815343
UniProtQ7S2X9

[Back to BioLiP]