Structure of PDB 5tgm Chain n1

Receptor sequence

>5tgmn1 (length=159) Species: 4932 (Saccharomyces cerevisiae)

GKSHGYRSRTRYMFQRDFRKHGAVHLSTYLKVYKVGDIVDIKANGSIQKG
MPHKFYQGKTGVVYNVTKSSVGVIINKMVGNRYLEKRLNLRVEHIKHSKC
RQEFLERVKANAAKRAEAKAQGVAVQLKRQPAQPRESRIVSTEGNVPQTL
APVPYETFI

3D structure

• PDB: 5tgm Molecular insights into protein synthesis with proline residues.
• Chain: n1
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	n1	G2 K3 S4 H5 G6 Y7 R8 S9 R10 R12 Y13 M14 Q16 R17 F19 H22 G23 K35 D41 K43 S47 Q49 K50 G51 H54 K55 Y57 Q58 G59 K60 T61 T68 K69 S70 S71 K78 R83 L85 K87 R88 N90 C101 R102 E104 F105 R108 N112 R116 Q127 K129 R130 Q131	G1 K2 S3 H4 G5 Y6 R7 S8 R9 R11 Y12 M13 Q15 R16 F18 H21 G22 K34 D40 K42 S46 Q48 K49 G50 H53 K54 Y56 Q57 G58 K59 T60 T67 K68 S69 S70 K77 R82 L84 K86 R87 N89 C100 R101 E103 F104 R107 N111 R115 Q126 K128 R129 Q130
BS02	rna	n1	R20 H26 L27 S28	R19 H25 L26 S27
BS03	OHX	n1	Y13 D18	Y12 D17

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5tgm, PDBe:5tgm, PDBj:5tgm
• PDBsum: 5tgm
• PubMed: 27827794
• UniProt: Q02753|RL21A_YEAST Large ribosomal subunit protein eL21A (Gene Name=RPL21A)