Structure of PDB 5i4l Chain n1

Receptor sequence

>5i4ln1 (length=159) Species: 559292 (Saccharomyces cerevisiae S288C)

GKSHGYRSRTRYMFQRDFRKHGAVHLSTYLKVYKVGDIVDIKANGSIQKG
MPHKFYQGKTGVVYNVTKSSVGVIINKMVGNRYLEKRLNLRVEHIKHSKC
RQEFLERVKANAAKRAEAKAQGVAVQLKRQPAQPRESRIVSTEGNVPQTL
APVPYETFI

3D structure

• PDB: 5i4l Amicoumacin A induces cancer cell death by targeting the eukaryotic ribosome.
• Chain: n1
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	n1	G2 K3 S4 H5 G6 Y7 R8 S9 R10 R12 Y13 M14 F15 Q16 R17 F19 H22 G23 K35 D41 K43 G46 S47 Q49 K50 G51 H54 K55 Y57 Q58 G59 K60 T61 T68 K69 S70 S71 K78 R83 K87 R88 L89 N90 R92 C101 R102 F105 R108 R116 Q127 K129 R130	G1 K2 S3 H4 G5 Y6 R7 S8 R9 R11 Y12 M13 F14 Q15 R16 F18 H21 G22 K34 D40 K42 G45 S46 Q48 K49 G50 H53 K54 Y56 Q57 G58 K59 T60 T67 K68 S69 S70 K77 R82 K86 R87 L88 N89 R91 C100 R101 F104 R107 R115 Q126 K128 R129
BS02	rna	n1	H26 L27 S28	H25 L26 S27
BS03	MG	n1	D41 G59	D40 G58
BS04	OHX	n1	Y13 D18	Y12 D17

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5i4l, PDBe:5i4l, PDBj:5i4l
• PDBsum: 5i4l
• PubMed: 27296282
• UniProt: Q02753|RL21A_YEAST Large ribosomal subunit protein eL21A (Gene Name=RPL21A)