Structure of PDB 5obm Chain n0

Receptor sequence

>5obmn0 (length=172) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

MAHFKEYQVIGRRLPTESVPEPKLFRMRIFASNEVIAKSRYWYFLQKLHK
VKKASGEIVSINQINEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSRV
AAVETLYQDMAARHRARFRSIHILKVAEIEKTADVKRQYVKQFLTKDLKF
PLPHRVQKSTKTFSYKRPSTFY

3D structure

PDB

5obm Aminoglycoside interactions and impacts on the eukaryotic ribosome.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	n0	A2 N62 N65 E66 H68 K71 S83 R84 S85 H88 M90 Y91 K92 Q108 A111 A112 R113 H114 R115 R117 T132 R137 Y139 L144 T145 K146 P153 H154 R155 Q157 K158 S159 K161 Y165 P168 S169 T170 F171	A2 N62 N65 E66 H68 K71 S83 R84 S85 H88 M90 Y91 K92 Q108 A111 A112 R113 H114 R115 R117 T132 R137 Y139 L144 T145 K146 P153 H154 R155 Q157 K158 S159 K161 Y165 P168 S169 T170 F171
BS02	rna	n0	S39 R40 Y43 Q46 K50 K52 K53 R84 R117 R119	S39 R40 Y43 Q46 K50 K52 K53 R84 R117 R119

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5obm, PDBe:5obm, PDBj:5obm
PDBsum	5obm
PubMed	29208708
UniProt	P0CX23\|RL20A_YEAST Large ribosomal subunit protein eL20A (Gene Name=RPL20A)

[Back to BioLiP]