Structure of PDB 8y38 Chain n

Receptor sequence
>8y38n (length=60) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
AKTSMVAKQQKKQKYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKG
QIPGVRKASW
3D structure
PDB8y38 Synthetic macrolides overcoming MLS B K-resistant pathogens.
Chainn
Resolution2.58 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna n A2 K3 T4 S5 M6 K9 K15 Y16 V18 R19 Y21 R29 S32 Y34 R35 R41 I42 R45 K58 S60 W61 A1 K2 T3 S4 M5 K8 K14 Y15 V17 R18 Y20 R28 S31 Y33 R34 R40 I41 R44 K57 S59 W60
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8y38, PDBe:8y38, PDBj:8y38
PDBsum8y38
PubMed38992047
UniProtP66413|RS14Z_STAAW Small ribosomal subunit protein uS14B (Gene Name=rpsZ)

[Back to BioLiP]