Structure of PDB 8wxe Chain n

Receptor sequence
>8wxen (length=37) Species: 9606 (Homo sapiens) [Search protein sequence]
TLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRT
3D structure
PDB8wxe Structures of human gamma delta T cell receptor-CD3 complex.
Chainn
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide n T258 A262 Y266 T7 A11 Y15
Gene Ontology
Molecular Function
GO:0036094 small molecule binding
Biological Process
GO:0002250 adaptive immune response
GO:0046629 gamma-delta T cell activation
GO:0050852 T cell receptor signaling pathway
Cellular Component
GO:0005886 plasma membrane
GO:0009897 external side of plasma membrane
GO:0042101 T cell receptor complex
GO:0042106 gamma-delta T cell receptor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wxe, PDBe:8wxe, PDBj:8wxe
PDBsum8wxe
PubMed38657677
UniProtP0CF51|TRGC1_HUMAN T cell receptor gamma constant 1 (Gene Name=TRGC1)

[Back to BioLiP]