Structure of PDB 8wib Chain n

Receptor sequence
>8wibn (length=116) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
ARLVGVDLPRDKRMEIALTYIYGIGRTRSNEILAATGIDKNMRTKDLTDD
QVTVLRDYIEGNLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRGQ
RTKTNARTRKGPKRTI
3D structure
PDB8wib Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
Chainn
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna n K13 R14 I17 Y23 I25 G26 R27 T28 R29 R44 D77 K81 R91 P97 V98 R99 Q101 R102 T103 K104 T105 N106 A107 R108 T109 K111 K114 R115 K12 R13 I16 Y22 I24 G25 R26 T27 R28 R43 D76 K80 R90 P96 V97 R98 Q100 R101 T102 K103 T104 N105 A106 R107 T108 K110 K113 R114
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wib, PDBe:8wib, PDBj:8wib
PDBsum8wib
PubMed38245551
UniProtA0QSL5|RS13_MYCS2 Small ribosomal subunit protein uS13 (Gene Name=rpsM)

[Back to BioLiP]