Structure of PDB 8wi9 Chain n

Receptor sequence

>8wi9n (length=116) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

ARLVGVDLPRDKRMEIALTYIYGIGRTRSNEILAATGIDKNMRTKDLTDD
QVTVLRDYIEGNLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRGQ
RTKTNARTRKGPKRTI

3D structure

• PDB: 8wi9 Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
• Chain: n
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	n	K13 I17 Y23 I25 G26 R27 T28 R29 R44 D77 I78 K81 Y87 R91 H92 P97 V98 R99 Q101 R102 T103 K104 T105 N106 A107 R108 T109 R110 K111 K114 R115 I117	K12 I16 Y22 I24 G25 R26 T27 R28 R43 D76 I77 K80 Y86 R90 H91 P96 V97 R98 Q100 R101 T102 K103 T104 N105 A106 R107 T108 R109 K110 K113 R114 I116

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8wi9, PDBe:8wi9, PDBj:8wi9
• PDBsum: 8wi9
• PubMed: 38245551
• UniProt: A0QSL5|RS13_MYCS2 Small ribosomal subunit protein uS13 (Gene Name=rpsM)