Structure of PDB 8t5d Chain n

Receptor sequence
>8t5dn (length=88) Species: 562 (Escherichia coli) [Search protein sequence]
SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHH
SRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR
3D structure
PDB8t5d How Dedicated Ribosomes Translate a Leaderless mRNA.
Chainn
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna n Q39 L56 V59 R87 Q39 L56 V59 R87
BS02 rna n S1 T4 N19 T21 G22 Q27 H37 L38 H41 H45 K47 D48 H49 H50 S51 R53 G54 R57 S60 Q61 K64 Y68 S1 T4 N19 T21 G22 Q27 H37 L38 H41 H45 K47 D48 H49 H50 S51 R53 G54 R57 S60 Q61 K64 Y68
External links