Structure of PDB 8q5i Chain n

Receptor sequence

>8q5in (length=155) Species: 5476 (Candida albicans) [Search protein sequence]

QVAPKWYQSEDVPAPKQTRKTARPQKLRASLVPGTVLILLAGRFRGKRVV
YLKNLEDNTLLVSGPFKVNGVPLRRVNARYVIATSTKVNVSGVDVSKFNV
EYFAREKEIKAERVADQKSVDAALLSEIKKTPLLKQYLAASFSLKNGDRP
HLLKF

3D structure

PDB

8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy

Chain

Resolution

2.45 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	n	W8 Y9 A16 P17 K18 Q19 T20 R21 K22 T23 R25 Q27 A43 G44 R45 F46 D59 T61 F68 K69 G72 P74 R76 R77 N79 R81 Y82 R107 E108 K128 I130 Q157 S162 K166 N167	W6 Y7 A14 P15 K16 Q17 T18 R19 K20 T21 R23 Q25 A41 G42 R43 F44 D57 T59 F66 K67 G70 P72 R74 R75 N77 R79 Y80 R105 E106 K107 I109 Q136 S141 K145 N146

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8q5i, PDBe:8q5i, PDBj:8q5i
PDBsum	8q5i
PubMed
UniProt	Q9P834

[Back to BioLiP]