Structure of PDB 8ovj Chain n

Receptor sequence

>8ovjn (length=33) Species: 347515 (Leishmania major strain Friedlin)

GTVSRPRGMRPKWHKKRIKRLKLRRRRMRQRSK

3D structure

• PDB: 8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
• Chain: n
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	n	G2 T3 V4 R6 G9 R11 P12 K13 W14 K16 K17 R18 K20 R21 L22 K23 R26 R27 R30 S33	G1 T2 V3 R5 G8 R10 P11 K12 W13 K15 K16 R17 K19 R20 L21 K22 R25 R26 R29 S32

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Dec 3 06:41:13 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8ovj', asym_id = 'n', title = 'Structural and mechanistic insights into the fun...some lacking a single pseudouridine modification.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8ovj', asym_id='n', title='Structural and mechanistic insights into the fun...some lacking a single pseudouridine modification.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '8ovj', asym_id = 'n'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='8ovj', asym_id='n')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>