Structure of PDB 8i0r Chain n |
>8i0rn (length=80) Species: 9606 (Homo sapiens) [Search protein sequence] |
MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNR EPVQLETLSIRGNNIRYFILPDSLPLDTLL |
|
PDB | 8i0r Molecular Basis for the activation of Human spliceosome |
Chain | n |
Resolution | 3.0 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
n |
K20 G62 N63 |
K20 G62 N63 |
|
|
|
|