Structure of PDB 8bh6 Chain n

Receptor sequence
>8bh6n (length=60) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
AKTSMVAKQQKKQKYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKG
QIPGVRKASW
3D structure
PDB8bh6 Ribosome maturation factor P (RimP) from Staphylococcus aureus
Chainn
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna n A2 K3 T4 S5 M6 K9 K12 K15 Y16 V18 R19 R29 H31 S32 V33 R35 K36 R41 I42 R45 K58 S60 A1 K2 T3 S4 M5 K8 K11 K14 Y15 V17 R18 R28 H30 S31 V32 R34 K35 R40 I41 R44 K57 S59
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bh6, PDBe:8bh6, PDBj:8bh6
PDBsum8bh6
PubMed
UniProtQ2FW19|RS14Z_STAA8 Small ribosomal subunit protein uS14B (Gene Name=rpsZ)

[Back to BioLiP]