Structure of PDB 8aaf Chain n

Receptor sequence

>8aafn (length=167) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

TAQQAPKWYPSEDVAAPKKTRKAVRPQKLRASLVPGTVLILLAGRFRGKR
VVYLKHLEDNTLLVTGPFKVNGVPLRRVNARYVIATSTKVSVEGVNVEKF
NVEYFAKEKLTKKEKKEANEIKTERVEDQKVVDKALLAEIKKTPLLKQYL
SASFSLKNGDKPHLLKF

3D structure

PDB

8aaf Molecular basis of eIF5A-dependent CAT tailing in eukaryotic ribosome-associated quality control.

Chain

Resolution

2.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	n	T2 A3 Q5 K8 W9 A17 P18 K19 K20 T21 R22 K23 A24 R26 Q28 K29 G45 R46 F47 R48 D60 N61 T62 F69 N72 G73 P75 R77 R78 N80 R82 K108 K110 I130 K131 Q157 A161 S162 K166 N167	T1 A2 Q4 K7 W8 A16 P17 K18 K19 T20 R21 K22 A23 R25 Q27 K28 G44 R45 F46 R47 D59 N60 T61 F68 N71 G72 P74 R76 R77 N79 R81 K107 K109 I121 K122 Q148 A152 S153 K157 N158

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8aaf, PDBe:8aaf, PDBj:8aaf
PDBsum	8aaf
PubMed	36804914
UniProt	P05739\|RL6B_YEAST Large ribosomal subunit protein eL6B (Gene Name=RPL6B)

[Back to BioLiP]