Structure of PDB 7vb9 Chain n

Receptor sequence
>7vb9n (length=38) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence]
LTDEQAQELHSVYMSGLWLFSAVAIVAHLAVYIWRPWF
3D structure
PDB7vb9 Structural basis for the assembly and quinone transport mechanisms of the dimeric photosynthetic RC-LH1 supercomplex.
Chainn
Resolution3.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SPO n L20 Y24 L28 L9 Y13 L17
BS02 BCL n F31 A38 H39 V42 F20 A27 H28 V31
BS03 BCL n F31 S32 H39 W48 F49 F20 S21 H28 W37 F38
BS04 SPO n A38 W45 A27 W34
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7vb9, PDBe:7vb9, PDBj:7vb9
PDBsum7vb9
PubMed35418573
UniProtQ3J1A3|LHB1_CERS4 Light-harvesting protein B-875 beta chain (Gene Name=pufB)

[Back to BioLiP]