Structure of PDB 7ryg Chain n

Receptor sequence
>7rygn (length=100) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
AKKGMINRELKREKTVAKYAAKRAELKATIANVNASDEERFEAMLKLQAL
PRNASPVRLRNRCGLTGRPHGYFRKFGLSRNKLRDTVMQGDVPGVVKASW
3D structure
PDB7ryg An Analysis of the Novel Fluorocycline TP-6076 Bound to Both the Ribosome and Multidrug Efflux Pump AdeJ from Acinetobacter baumannii.
Chainn
Resolution2.38 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna n K4 M6 N8 R9 R13 R53 S56 V58 R59 R61 N62 R63 T67 R69 H71 G72 R75 R81 N82 R85 S100 W101 K3 M5 N7 R8 R12 R52 S55 V57 R58 R60 N61 R62 T66 R68 H70 G71 R74 R80 N81 R84 S99 W100
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7ryg, PDBe:7ryg, PDBj:7ryg
PDBsum7ryg
PubMed35100868
UniProtB7IA26|RS14_ACIB5 Small ribosomal subunit protein uS14 (Gene Name=rpsN)

[Back to BioLiP]