Structure of PDB 7r6q Chain n

Receptor sequence

>7r6qn (length=425) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]

MRIKKKNTRGNARNFITRSQAVRKLQVSLADFRRLCIFKGIYPREPRNKK
KANKGSTAPTTFYYAKDIQYLMHEPVLAKFREHKTFARKLTRALGRGEVS
SAKRLEENRDSYTLDHIIKERYPSFPDAIRDIDDALNMLFLFSNLPSTNQ
VSSKIINDAQKICNQWLAYVAKERLVRKVFVSIKGVYYQANIKGEEVRWL
VPFKFPENIPSDVDFRIMLTFLEFYSTLLHFVLYKLYTDSGLIYPPKLDL
KKDKIISGLSSYILESRYDSPVASLFSAFVFYVSREVPIDILEFLILSCG
GNVISEAAMDQIIDMSKVTHQIVDRPVLKNKVAGRTYIQPQWIFDCINKG
ELVPANKYLPGEALPPHLSPWGDAIGYDPTAPKKLKMIMMSNKQKKLYKK
MKYSNAKKEEQAENLKKKKKQIAKQ

3D structure

PDB

7r6q Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.

Chain

Resolution

2.98 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	n	M1 R2 I3 K6 R9 G10 N11 R18 S19 R23 S28 L29 A30 R33 R34 R47 K50 K51 T57 K84 A87 R88 K89 T91 R92 R96 R104 N149 Q150 D212 D214 R216 I217 T220 K562 K565 L566 K569 M570 Y572 S573 N574	M1 R2 I3 K6 R9 G10 N11 R18 S19 R23 S28 L29 A30 R33 R34 R47 K50 K51 T57 K84 A87 R88 K89 T91 R92 R96 R104 N149 Q150 D212 D214 R216 I217 T220 K393 K396 L397 K400 M401 Y403 S404 N405
BS02	rna	n	R2 R9 G10 N11 N14 R47 Q69 H73 T85 R88 K89	R2 R9 G10 N11 N14 R47 Q69 H73 T85 R88 K89

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0005515	protein binding
GO:0043021	ribonucleoprotein complex binding
GO:0070180	large ribosomal subunit rRNA binding

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466	maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364	rRNA processing
GO:0042254	ribosome biogenesis
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0030687	preribosome, large subunit precursor
GO:0070545	PeBoW complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7r6q, PDBe:7r6q, PDBj:7r6q
PDBsum	7r6q
PubMed	36482249
UniProt	P53261\|PESC_YEAST Pescadillo homolog (Gene Name=NOP7)

[Back to BioLiP]