Structure of PDB 7pjv Chain n

Receptor sequence
>7pjvn (length=101) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
AKQSMKAREVKRVALADKYFAKRAELKAIISDVNAASDEDRWNAVLKLQT
LPRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKAS
W
3D structure
PDB7pjv Structural mechanism of GTPase-powered ribosome-tRNA movement.
Chainn
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna n K2 Q3 S4 M5 A7 R8 R12 F20 K22 R23 K27 Q49 R53 S56 S58 R59 R61 R63 T67 R69 H71 G72 F73 R75 R81 I82 R85 K98 S100 W101 K2 Q3 S4 M5 A7 R8 R12 F20 K22 R23 K27 Q49 R53 S56 S58 R59 R61 R63 T67 R69 H71 G72 F73 R75 R81 I82 R85 K98 S100 W101
BS02 MG n K6 G68 K6 G68
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pjv, PDBe:7pjv, PDBj:7pjv
PDBsum7pjv
PubMed34635670
UniProtP0AG59|RS14_ECOLI Small ribosomal subunit protein uS14 (Gene Name=rpsN)

[Back to BioLiP]