Structure of PDB 7pir Chain n

Receptor sequence

>7pirn (length=112) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]

MKTRTEQRRLRHKRIVKKIRATNHDNRVVLMVIKSLNHISVQAWDFSQNI
VLASSSSLALKLKNNAKLVGQDIADKLVKLKLTNVVFDTGGSKYHGRIAA
LAEAARERGLNF

3D structure

PDB

7pir Visualizing translation dynamics at atomic detail inside a bacterial cell.

Chain

Resolution

12.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	n	M1 Q7 L10 R11 R14 K17 K18 T22 N23 R27 V90 T93 G95 S96 K97 Y98 R110 F116	M1 Q7 L10 R11 R14 K17 K18 T22 N23 R27 V86 T89 G91 S92 K93 Y94 R106 F112
BS02	rna	n	T3 R4 T5 R8 R11 M31 K34 S35 L36 N37 H38 Q42 W44 N49 I50 V51 S57 L58 K63 N64 N69 G95 S96 H99 G100 R101	T3 R4 T5 R8 R11 M31 K34 S35 L36 N37 H38 Q42 W44 N49 I50 V51 S57 L58 K63 N64 N65 G91 S92 H95 G96 R97

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7pir, PDBe:7pir, PDBj:7pir
PDBsum	7pir
PubMed	36171285
UniProt	Q50302\|RL18_MYCPN Large ribosomal subunit protein uL18 (Gene Name=rplR)