Structure of PDB 7pib Chain n

Receptor sequence
>7pibn (length=112) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
MKTRTEQRRLRHKRIVKKIRATNHDNRVVLMVIKSLNHISVQAWDFSQNI
VLASSSSLALKLKNNAKLVGQDIADKLVKLKLTNVVFDTGGSKYHGRIAA
LAEAARERGLNF
3D structure
PDB7pib Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chainn
Resolution4.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna n K2 L10 R11 R14 K18 R27 V90 Y98 R110 F116 K2 L10 R11 R14 K18 R27 V86 Y94 R106 F112
BS02 rna n T3 R4 T5 R9 K13 R20 K34 S35 L36 N37 H38 W44 N49 V51 L58 N69 S96 H99 R101 T3 R4 T5 R9 K13 R20 K34 S35 L36 N37 H38 W44 N49 V51 L58 N65 S92 H95 R97
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pib, PDBe:7pib, PDBj:7pib
PDBsum7pib
PubMed36171285
UniProtQ50302|RL18_MYCPN Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]