Structure of PDB 7p7t Chain n

Receptor sequence

>7p7tn (length=114) Species: 1351 (Enterococcus faecalis) [Search protein sequence]

RIAGVDIPRDKRVVVSLTYIYGIGNTTAKKVLANVGVSEDVRVRDLTNEQ
TDAIRAEIDKLKVEGDLRREVNLNIKRLMEIGSYRGIRHRRGLPTRGQNT
KNNARTRKGPTKTV

3D structure

PDB

7p7t Structural basis for PoxtA-mediated resistance to phenicol and oxazolidinone antibiotics.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	n	K13 R14 V17 Y21 Y23 G24 I25 G26 T28 T29 R44 Y86 R87 R90 H91 P96 T97 R98 Q100 N101 T102 K103 N104 N105 A106 R107 T108 R109 K110 T113 K114	K11 R12 V15 Y19 Y21 G22 I23 G24 T26 T27 R42 Y84 R85 R88 H89 P94 T95 R96 Q98 N99 T100 K101 N102 N103 A104 R105 T106 R107 K108 T111 K112
BS02	MG	n	T20 I22 I25	T18 I20 I23

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

External links