Structure of PDB 7p7r Chain n

Receptor sequence

>7p7rn (length=114) Species: 226185 (Enterococcus faecalis V583)

RIAGVDIPRDKRVVVSLTYIYGIGNTTAKKVLANVGVSEDVRVRDLTNEQ
TDAIRAEIDKLKVEGDLRREVNLNIKRLMEIGSYRGIRHRRGLPTRGQNT
KNNARTRKGPTKTV

3D structure

• PDB: 7p7r Structural basis for PoxtA-mediated resistance to phenicol and oxazolidinone antibiotics.
• Chain: n
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	n	K13 R14 V17 Y21 Y23 G24 I25 G26 T28 T29 R44 N76 R87 R90 H91 P96 T97 R98 Q100 N101 T102 K103 N104 N105 A106 R107 T108 R109 K110 T113 K114	K11 R12 V15 Y19 Y21 G22 I23 G24 T26 T27 R42 N74 R85 R88 H89 P94 T95 R96 Q98 N99 T100 K101 N102 N103 A104 R105 T106 R107 K108 T111 K112
BS02	MG	n	T20 I22 I25	T18 I20 I23

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7p7r, PDBe:7p7r, PDBj:7p7r
• PDBsum: 7p7r
• PubMed: 35387982
• UniProt: P59754|RS13_ENTFA Small ribosomal subunit protein uS13 (Gene Name=rpsM)