Structure of PDB 7oii Chain n

Receptor sequence

>7oiin (length=99) Species: 562 (Escherichia coli)

RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLIS
PHVNKDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG

3D structure

• PDB: 7oii A switch from alpha-helical to beta-strand conformation during co-translational protein folding.
• Chain: n
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	n	R7 R9 H15 R37 G38 P39 I40 P41 P43 T44 R45 I53 S54 P55 H56 V57 N58 K59 R62 Q64 R68 H70 R72 L73	R3 R5 H11 R33 G34 P35 I36 P37 P39 T40 R41 I49 S50 P51 H52 V53 N54 K55 R58 Q60 R64 H66 R68 L69

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Nov 17 23:47:06 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7oii', asym_id = 'n', title = 'A switch from alpha-helical to beta-strand conformation during co-translational protein folding.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7oii', asym_id='n', title='A switch from alpha-helical to beta-strand conformation during co-translational protein folding.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412', uniprot = '', pdbid = '7oii', asym_id = 'n'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412', uniprot='', pdbid='7oii', asym_id='n')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>