Structure of PDB 7o9m Chain n

Receptor sequence

>7o9mn (length=215) Species: 9606 (Homo sapiens)

KNRTGAEHLWLTRHLRDPFVKAAKVESYRCRSAFKLLEVNERHQILRPGL
RVLDCGAAPGAWSQVAVQKVNAAGTDPSSPVGFVLGVDLLHIFPLEGATF
LCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLISLC
LTLLSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEASR
KESSEVYFLATQYHG

3D structure

• PDB: 7o9m Structural basis for late maturation steps of the human mitoribosomal large subunit.
• Chain: n
• Resolution: 2.6 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	n	K25 N26 R27 A30 E31 H32 W34 L35 L39 R40 P42 K48 C54 R55 K59 A156 N158 A159 T160 G161 R163 W196 A197 S199 R216 I217 K225 S227 E229	K1 N2 R3 A6 E7 H8 W10 L11 L15 R16 P18 K24 C30 R31 K35 A132 N134 A135 T136 G137 R139 W172 A173 S175 R192 I193 K201 S203 E205
BS02	MG	n	R37 E226	R13 E202

Gene Ontology

Molecular Function

• GO:0008168 methyltransferase activity
• GO:0008650 rRNA (uridine-2'-O-)-methyltransferase activity

Biological Process

• GO:0000451 rRNA 2'-O-methylation
• GO:0001510 RNA methylation
• GO:0006364 rRNA processing
• GO:0031167 rRNA methylation
• GO:0032259 methylation
• GO:0042254 ribosome biogenesis
• GO:1902775 mitochondrial large ribosomal subunit assembly

Cellular Component

• GO:0005730 nucleolus
• GO:0005739 mitochondrion
• GO:0005759 mitochondrial matrix

External links

• PDB: RCSB:7o9m, PDBe:7o9m, PDBj:7o9m
• PDBsum: 7o9m
• PubMed: 34135318
• UniProt: Q9UI43|MRM2_HUMAN rRNA methyltransferase 2, mitochondrial (Gene Name=MRM2)