Structure of PDB 7o9k Chain n

Receptor sequence
>7o9kn (length=189) Species: 9606 (Homo sapiens) [Search protein sequence]
SYRCRSAFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNAAGTD
PSSPVGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADV
ILSDMAPNATGFRDLDHDRLISLCLTLLSVTPDILQPGGTFLCKTWAGSQ
SRRLQRRLTEEFQNVRIIKPEASRKESSEVYFLATQYHG
3D structure
PDB7o9k Structural basis for late maturation steps of the human mitoribosomal large subunit.
Chainn
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.1.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna n A159 T160 G161 A197 R216 K225 E226 S227 A109 T110 G111 A147 R166 K175 E176 S177
BS02 SAH n S56 G80 A81 A82 D112 L113 D129 V130 D154 A156 L173 S6 G30 A31 A32 D62 L63 D79 V80 D104 A106 L123
Gene Ontology
Molecular Function
GO:0008168 methyltransferase activity
GO:0008650 rRNA (uridine-2'-O-)-methyltransferase activity
Biological Process
GO:0000451 rRNA 2'-O-methylation
GO:0001510 RNA methylation
GO:0006364 rRNA processing
GO:0031167 rRNA methylation
GO:0032259 methylation
GO:0042254 ribosome biogenesis
GO:1902775 mitochondrial large ribosomal subunit assembly
Cellular Component
GO:0005730 nucleolus
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7o9k, PDBe:7o9k, PDBj:7o9k
PDBsum7o9k
PubMed34135318
UniProtQ9UI43|MRM2_HUMAN rRNA methyltransferase 2, mitochondrial (Gene Name=MRM2)

[Back to BioLiP]