Structure of PDB 7nhl Chain n

Receptor sequence

>7nhln (length=116) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325)

RIAGVDIPREKRVVISLTYIYGIGTSTAQKILEEANVSADTRVKDLTDDE
LGRIREVVDGYKVEGDLRRETNLNIKRLMEISSYRGIRHRRGLPVRGQKT
KNNARTRKGPVKTVAN

3D structure

• PDB: 7nhl Structural basis of ABCF-mediated resistance to pleuromutilin, lincosamide, and streptogramin A antibiotics in Gram-positive pathogens.
• Chain: n
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	n	A117 N118	A115 N116
BS02	rna	n	K13 R14 I17 Y21 Y23 G24 I25 G26 S28 R44 Y86 R90 H91 P96 V97 R98 G99 Q100 K101 T102 K103 N104 N105 A106 R107 T108 R109 K110 K114 T115 V116	K11 R12 I15 Y19 Y21 G22 I23 G24 S26 R42 Y84 R88 H89 P94 V95 R96 G97 Q98 K99 T100 K101 N102 N103 A104 R105 T106 R107 K108 K112 T113 V114

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7nhl, PDBe:7nhl, PDBj:7nhl
• PDBsum: 7nhl
• PubMed: 34117249
• UniProt: Q2FW30|RS13_STAA8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)