Structure of PDB 7msm Chain n

Receptor sequence
>7msmn (length=60) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
AKKALVNKAAGKPRFAVRAYTRCSKCGRPRAVYRKFGLCRICLREMAHAG
ELPGVQKSSW
3D structure
PDB7msm Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
Chainn
Resolution2.79 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna n A2 K3 K4 A5 K9 F16 V18 R19 Y21 C27 R29 R31 A32 V33 R35 R41 I42 R45 K58 S60 W61 A1 K2 K3 A4 K8 F15 V17 R18 Y20 C26 R28 R30 A31 V32 R34 R40 I41 R44 K57 S59 W60
BS02 ZN n C24 C27 C40 C43 C23 C26 C39 C42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7msm, PDBe:7msm, PDBj:7msm
PDBsum7msm
PubMed35064151
UniProtP9WH57|RS14Z_MYCTU Small ribosomal subunit protein uS14B (Gene Name=rpsZ)

[Back to BioLiP]