Structure of PDB 7f9o Chain n

Receptor sequence
>7f9on (length=84) Species: 77009 (Hordeum vulgare subsp. spontaneum) [Search protein sequence]
YIGSSTNLIMVTTTTLMLFAGRFGLAPSANRKATAGLKLEARESGLQTGD
PAGFTLADTLACGAVGHIMGVGIVLGLKNTGVLD
3D structure
PDB7f9o Architecture of the chloroplast PSI-NDH supercomplex in Hordeum vulgare.
Chainn
Resolution4.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA n A103 A107 A57 A61
BS02 CLA n P73 K78 A79 P27 K32 A33
BS03 CLA n R68 G95 D96 P97 T105 R22 G49 D50 P51 T59
BS04 CLA n I114 G118 I119 K124 I68 G72 I73 K78
BS05 CLA n N53 H113 N7 H67
BS06 CLA n L62 L71 L83 K84 L16 L25 L37 K38
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7f9o, PDBe:7f9o, PDBj:7f9o
PDBsum7f9o
PubMed34879391
UniProtP36886|PSAK_HORVU Photosystem I reaction center subunit psaK, chloroplastic (Gene Name=PSAK)

[Back to BioLiP]