Structure of PDB 6yss Chain n

Receptor sequence

>6yssn (length=101) Species: 562 (Escherichia coli)

AKQSMKAREVKRVALADKYFAKRAELKAIISDVNAASDEDRWNAVLKLQT
LPRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKAS
W

3D structure

• PDB: 6yss Mechanism of ribosome rescue by alternative ribosome-rescue factor B.
• Chain: n
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	n	A1 K2 Q3 S4 M5 A7 R8 R12 F20 R23 K27 Q49 R53 S56 S58 R59 R61 N62 R63 T67 R69 H71 G72 R75 R81 I82 R85 K98 S100 W101	A1 K2 Q3 S4 M5 A7 R8 R12 F20 R23 K27 Q49 R53 S56 S58 R59 R61 N62 R63 T67 R69 H71 G72 R75 R81 I82 R85 K98 S100 W101
BS02	MG	n	K6 T67 G68	K6 T67 G68

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Dec 1 17:15:01 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6yss', asym_id = 'n', title = 'Mechanism of ribosome rescue by alternative ribosome-rescue factor B.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6yss', asym_id='n', title='Mechanism of ribosome rescue by alternative ribosome-rescue factor B.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6yss', asym_id = 'n'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6yss', asym_id='n')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>