Structure of PDB 6w6p Chain n

Receptor sequence
>6w6pn (length=60) Species: 474186 (Enterococcus faecalis OG1RF) [Search protein sequence]
AKKSMIAKNKRPAKHSTQAYTRCERCGRPHSVYRKFHLCRICFRELAYKG
QIPGVKKASW
3D structure
PDB6w6p Cryo-electron microscopy structure of the 70S ribosome from Enterococcus faecalis.
Chainn
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna n A2 K3 K4 S5 M6 K15 H16 S17 T18 Q19 Y21 C27 R29 H31 S32 R35 R41 R45 K58 S60 W61 A1 K2 K3 S4 M5 K14 H15 S16 T17 Q18 Y20 C26 R28 H30 S31 R34 R40 R44 K57 S59 W60
BS02 ZN n C24 C40 C43 C23 C39 C42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6w6p, PDBe:6w6p, PDBj:6w6p
PDBsum6w6p
PubMed33004869
UniProtA0A1B4XKT0

[Back to BioLiP]