Structure of PDB 6gxo Chain n

Receptor sequence
>6gxon (length=101) Species: 562 (Escherichia coli) [Search protein sequence]
AKQSMKAREVKRVALADKYFAKRAELKAIISDVNAASDEDRWNAVLKLQT
LPRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKAS
W
3D structure
PDB6gxo Visualization of translation termination intermediates trapped by the Apidaecin 137 peptide during RF3-mediated recycling of RF1.
Chainn
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna n A1 K2 S4 M5 A7 R8 R12 K27 R53 S56 S58 R59 R61 R63 T67 R69 H71 G72 F73 R75 R81 I82 R85 K98 S100 W101 A1 K2 S4 M5 A7 R8 R12 K27 R53 S56 S58 R59 R61 R63 T67 R69 H71 G72 F73 R75 R81 I82 R85 K98 S100 W101
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gxo, PDBe:6gxo, PDBj:6gxo
PDBsum6gxo
PubMed30076302
UniProtP0AG59|RS14_ECOLI Small ribosomal subunit protein uS14 (Gene Name=rpsN)

[Back to BioLiP]