Structure of PDB 5z3g Chain n

Receptor sequence

>5z3gn (length=72) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

KSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGAKAKRRHTTGTGR
MRYLKHVSRRFKNGFQTGSASK

3D structure

PDB

5z3g Cryo-EM structure of an early precursor of large ribosomal subunit reveals a half-assembled intermediate.

Chain

Resolution

3.65 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	n	H16 R24 H28 S35 K43 T44 R45 Y47 N48 W49 K52 R55 R56 T58	H3 R11 H15 S22 K30 T31 R32 Y34 N35 W36 K39 R42 R43 T45
BS02	rna	n	R21 T59 G60 T61 G62 R63 M64 R65 Y66 L67 K68 V70 S71 R72 F74 N76 Q79 T80 G81 S82 A83 K85	R8 T46 G47 T48 G49 R50 M51 R52 Y53 L54 K55 V57 S58 R59 F61 N63 Q66 T67 G68 S69 A70 K72

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0000448	cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0030687	preribosome, large subunit precursor
GO:0044391	ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:5z3g, PDBe:5z3g, PDBj:5z3g
PDBsum	5z3g
PubMed	29557065
UniProt	P49166\|RL37A_YEAST Large ribosomal subunit protein eL37A (Gene Name=RPL37A)