Structure of PDB 4v4j Chain n

Receptor sequence
>4v4jn (length=125) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEA
EVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQ
RTRTNARTRKGPRKTVAGKKKAPRK
3D structure
PDB4v4j Interactions and dynamics of the Shine Dalgarno helix in the 70S ribosome.
Chainn
Resolution3.83 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna n K79 R93 K78 R92
BS02 rna n R14 G24 I25 G26 R29 R88 V98 R99 Q101 R102 T103 R104 N106 A107 R108 T109 R110 K111 R114 T116 A118 R13 G23 I24 G25 R28 R87 V97 R98 Q100 R101 T102 R103 N105 A106 R107 T108 R109 K110 R113 T115 A117
BS03 peptide n K27 A28 K26 A27
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4j, PDBe:4v4j, PDBj:4v4j
PDBsum4v4j
PubMed17940016
UniProtP80377|RS13_THET8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)

[Back to BioLiP]