Structure of PDB 3jd5 Chain n

Receptor sequence

>3jd5n (length=72) Species: 9913 (Bos taurus) [Search protein sequence]

RNVLKIRRRKMNHHKYRKLVKRTRFLRRKVREARLKRKQMKFERDLRRIW
QKAGLKEAPPGWQTPKIYLKGK

3D structure

PDB

3jd5 Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.

Chain

Resolution

7.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	n	R128 N129 L131 K132 I133 R134 R135 R136 K137 M138 N139 H140 H141 K142 Y143 K145 L146 V147 K148 L153 R154 R158 R161 R164 K165 R171 R174 I176 Q178 K179 A180 K183 Y195 K197 G198 K199	R1 N2 L4 K5 I6 R7 R8 R9 K10 M11 N12 H13 H14 K15 Y16 K18 L19 V20 K21 L26 R27 R31 R34 R37 K38 R44 R47 I49 Q51 K52 A53 K56 Y68 K70 G71 K72

Gene Ontology

	Molecular Function
GO:0016301	kinase activity

	Biological Process
GO:0016310	phosphorylation

	Cellular Component
GO:0005739	mitochondrion

External links