Structure of PDB 5tga Chain m7

Receptor sequence

>5tgam7 (length=155) Species: 4932 (Saccharomyces cerevisiae)

ARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQV
LDHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAAN
AEAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVVT
EKEEA

3D structure

• PDB: 5tga Molecular insights into protein synthesis with proline residues.
• Chain: m7
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	m7	R3 Y4 S16 R18 Y21 R23 S25 F26 K27 R30 Q34 Q55 R56 R62 F63 N64 S65 S66 I67 G68 R69 A71 Q72 K74 E75 K80 R82 W83 P84 A85 K86 N97 N101 Q118 V119 N120 Q121 R127 T129 Y130 R131 A132 H133 G134 R135 I136 N137 K138 Y139 E140 S141	R2 Y3 S15 R17 Y20 R22 S24 F25 K26 R29 Q33 Q54 R55 R61 F62 N63 S64 S65 I66 G67 R68 A70 Q71 K73 E74 K79 R81 W82 P83 A84 K85 N96 N100 Q117 V118 N119 Q120 R126 T128 Y129 R130 A131 H132 G133 R134 I135 N136 K137 Y138 E139 S140
BS02	rna	m7	R3 Y4 G5 A6 R61 R62 N120 Q121 H145	R2 Y3 G4 A5 R60 R61 N119 Q120 H144
BS03	OHX	m7	D53 H54 Q55	D52 H53 Q54
BS04	MG	m7	N120 Q121	N119 Q120
BS05	MG	m7	R127 Y139 S141	R126 Y138 S140
BS06	MG	m7	Q118 V119	Q117 V118
BS07	MG	m7	G5 A6 H116	G4 A5 H115

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5tga, PDBe:5tga, PDBj:5tga
• PDBsum: 5tga
• PubMed: 27827794
• UniProt: P05740|RL17A_YEAST Large ribosomal subunit protein uL22A (Gene Name=RPL17A)