Structure of PDB 8fxr Chain m5 |
>8fxrm5 (length=137) Species: 2557550 (Agrobacterium phage Milano) [Search protein sequence] |
MNFNVGVDFPSFIAWDGEESFPVKVDGFNQFGFTFKTIAALTAATTFNIF YHEPSDADPCVPGPAIRVPEVPFCDTVLLSEDGLAAVTLPETVTPDSFCA GTVPCMNGQWISIAPATGSETNAANVQITVTMKGATR |
|
PDB | 8fxr Neck and capsid architecture of the robust Agrobacterium phage Milano. |
Chain | m5 |
Resolution | 4.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
m5 |
F28 C60 |
F28 C60 |
|
|
|