Structure of PDB 5m1j Chain m5

Receptor sequence
>5m1jm5 (length=52) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
IIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRPKKK
LK
3D structure
PDB5m1j Structural insights into ribosomal rescue by Dom34 and Hbs1 at near-atomic resolution.
Chainm5
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna m5 R97 Y100 R102 P104 R106 N109 R111 K112 R113 K114 G116 R122 K124 K125 R21 Y24 R26 P28 R30 N33 R35 K36 R37 K38 G40 R46 K48 K49
BS02 MG m5 R102 L103 P104 R26 L27 P28
BS03 MG m5 C99 K114 C23 K38
BS04 ZN m5 C96 C110 C115 C20 C34 C39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5m1j, PDBe:5m1j, PDBj:5m1j
PDBsum5m1j
PubMed27995908
UniProtP0CH08|RL40A_YEAST Ubiquitin-ribosomal protein eL40A fusion protein (Gene Name=RPL40A)

[Back to BioLiP]